General Information

  • ID:  hor007017
  • Uniprot ID:  P34005
  • Protein name:  Somatotropin
  • Gene name:  Ostn
  • Organism:  Chelonia mydas
  • Family:  Somatotropin/prolactin family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Testudines; Cryptodira; Chelonioidea; Cheloniidae; Chelonia.
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0005131 growth hormone receptor binding; GO:0008083 growth factor activity; GO:0046872 metal ion binding; GO:0005179 hormone activity
  • GO CC:  GO:0048513 animal organ development; GO:0060396 growth hormone receptor signaling pathway; GO:0045927 positive regulation of growth; GO:0046427 positive regulation of receptor signaling pathway via JAK-STAT; GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein; GO:0031667 response to nutrient levels

Sequence Information

  • Sequence:  AFPAMPLSSLFANAVLRAQHLHLLAADTYKEFERTYIPEEQRHSNKISQSASCYSETIPAPTGKDDAEQKSDMELLRFSLILIQSWLNPVQFLSRVFTNSLVFGTSDRVYEKLRDLEEGIQALMRELEDGSLRGFQVLRPTYDKFDINLRNEDALLKNYGLLSCFKKDLHKVETYLKLMKCRRFGESNCTI
  • Length:  191
  • Propeptide:  AFPAMPLSSLFANAVLRAQHLHLLAADTYKEFERTYIPEEQRHSNKISQSASCYSETIPAPTGKDDAEQKSDMELLRFSLILIQSWLNPVQFLSRVFTNSLVFGTSDRVYEKLRDLEEGIQALMRELEDGSLRGFQVLRPTYDKFDINLRNEDALLKNYGLLSCFKKDLHKVETYLKLMKCRRFGESNCTI
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA